PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF066100070CFD_t1
Common NameTRAES_3BF066100070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 179aa    MW: 18996 Da    PI: 10.7508
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF066100070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-1088131245
                              XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                              ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L
  TRAES3BF066100070CFD_t1  88 KEQNRLKRLLRNRVSAQQARERKKAYMTELEVKAKDLELRNAEL 131
                              78899***********************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-1287151IPR004827Basic-leucine zipper domain
PfamPF001704.0E-1188149IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.05989152IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-1692151No hitNo description
SuperFamilySSF579595.38E-1292149No hitNo description
CDDcd147041.13E-1392142No hitNo description
PROSITE patternPS00036094109IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MAAQEQEQQA KTSTTSSLPS SSDRSSSSGP NNLKEGGAES DEEIRRVPEM GGGSASSGAG  60
DGKQLQLAAA GGGQAPAGKK RGRAAGDKEQ NRLKRLLRNR VSAQQARERK KAYMTELEVK  120
AKDLELRNAE LEQKVSTLQN ENNTLRQILK NTTAHAGKKP SGGKGGDSGK KHHHHFGKG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17783GKKRGRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3656480.0AK365648.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2035O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569436.18e-69PREDICTED: transcription factor HY5-like
SwissprotQ9SM505e-45HY5_SOLLC; Transcription factor HY5
TrEMBLA0A077RQT71e-125A0A077RQT7_WHEAT; Uncharacterized protein
STRINGBRADI2G04590.12e-68(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.14e-29bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]